WebSee all IRE1 proteins and peptides Expression system Wheat germ Accession O75460 Protein length Protein fragment Animal free No Nature Recombinant Species Human Sequence EEVINLVDQTSENAPTTVSRDVEEKPAHAPARPEAPVDSMLKDMATIILS TFLLIGWVAFIITYPLSMHQQQQLQHQQFQKELEKIQLLQQQQQQLPFHP Predicted molecular …
Did you know?
WebIRE1; DNA Stain; Cytoskeleton 细胞骨架 ... *The above data is based on the productmolecular weight 600.48. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions. 化学数据 Web288 rows · IRE1 alpha is a transmembrane protein that has both serine-threonine kinase …
WebMolecular Weight: 518.53: Formula: C 28 H 25 F 3 N 6 O. CAS No. 1589527-65-0: Storage: 3 years-20°C: powder: 1 years-80°C: in solvent: Shipping: Room temperature … WebOct 15, 2024 · Here, we combine protein-protein docking with molecular dynamics simulations to derive human IRE1 tetramer models and identify a molecular mechanism …
WebIRE1 alpha is a transmembrane protein that has both serine-threonine kinase and endoribonuclease activities and has a theoretical molecular weight of 110 kDa. When detecting phospho-IRE1 alpha, it is recommended to normalize its band intensity with total IRE1 alpha. References 1. Zheng, W., Xie, W., Yin, D., Luo, R., Liu, M., & Guo, F. (2024). WebNov 13, 2024 · Despite being the most well-studied arm of the UPR, the molecular mechanism of IRE1 activation remains somewhat controversial, with multiple proposed models, all of which involve ER stress sensing by the IRE1 luminal domain. ... including weight loss and pancreatic toxicity (121, 122). Regardless, PERK kinase inhibitors have …
WebEmpirical Formula (Hill Notation): C15H13NO4 Molecular Weight: 271.27 MDL number: MFCD32671869 Pricing and availability is not currently available. Properties Quality Level 100 assay ≥97% (HPLC) form solid manufacturer/tradename Calbiochem® storage condition OK to freeze protect from light color tan solubility DMSO: 100 mg/mL shipped in …
WebIRE1 alpha is a transmembrane protein that has both serine-threonine kinase and endoribonuclease activities and has a theoretical molecular weight of 110 kDa. When detecting phospho-IRE1 alpha, it is recommended to normalize its band intensity with total IRE1 alpha. References 1. Zheng, W., Xie, W., Yin, D., Luo, R., Liu, M., & Guo, F. (2024). high alpha 1 globulin 0.4WebFeb 5, 2024 · Inositol-requiring enzyme type 1 (IRE1) is a serine/threonine kinase acting as one of three branches of the Unfolded Protein Response (UPR) signaling pathway, which … high alpha bottleworksWebIRE1β is a close paralogue of the ubiquitously expressed IRE1α ( Tirasophon et al., 1998 ). Both are dual kinase/endonucleases that splice XBP1 mRNA to produce the transcription factor XBP1, which functions to induce the UPR ( Calfon et … how far is goodman mo from bixby okWebApr 12, 2024 · Western blot analysis of extracts from CHO IR/IRS-1 cells (transfected with insulin receptor and IRS-1), untreated or insulin-treated (100 nM for 5 min), showing an increase in phospho-IRS-1 (Ser307) with insulin stimulation, using Phospho-IRS-1 (Ser307) Antibody. Show More how far is gondar from addis ababaWebOct 15, 2024 · IRE1 represents the most evolutionary conserved branch of the UPR signaling pathway. The protein is structurally organized into three domains: an N-terminal luminal … highalphabetWebMar 9, 2024 · IRE1α Antibody (B-12) is a mouse monoclonal IgG 1 κ IRE1α antibody, cited in 50 publications, provided at 200 µg/ml. raised against amino acids 371-560 of IRE1α of … high alpha 2 globulin causesWebDec 24, 2024 · IRE1 is the most evolutionarily conserved sensor and is found from yeast to metazoans. Unfolded proteins serve as direct ligands for IRE1’s lumenal sensor domain, promoting its oligomerization and activation in the plane of the ER membrane ( Aragón et al., 2009; Gardner and Walter, 2011; Karagöz et al., 2024; Kimata et al., 2007; Li et al., 2010 ). high alphabet system